General Information

  • ID:  hor000863
  • Uniprot ID:  P14138
  • Protein name:  Endothelin-3
  • Gene name:  EDN3
  • Organism:  Homo sapiens (Human)
  • Family:  Endothelin/sarafotoxin family
  • Source:  Human
  • Expression:  Expressed in trophoblasts and placental stem villi vessels, but not in cultured placental smooth muscle cells.
  • Disease:  Diseases associated with EDN3 include Waardenburg Syndrome, Type 4B and Hirschsprung Disease 4.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0031708 endothelin B receptor binding
  • GO BP:  GO:0001755 neural crest cell migration; GO:0002690 positive regulation of leukocyte chemotaxis; GO:0003100 regulation of systemic arterial blood pressure by endothelin; GO:0006874 intracellular calcium ion homeostasis; GO:0007165 signal transduction; GO:0007166 cell surface receptor signaling pathway; GO:0007267 cell-cell signaling; GO:0007411 axon guidance; GO:0008015 blood circulation; GO:0008283 cell population proliferation; GO:0008284 positive regulation of cell population proliferation; GO:0010460 positive regulation of heart rate; GO:0010468 regulation of gene expression; GO:0010961 intracellular magnesium ion homeostasis; GO:0014824 artery smooth muscle contraction; GO:0014826 vein smooth muscle contraction; GO:0019229 regulation of vasoconstriction; GO:0030072 peptide hormone secretion; GO:0030182 neuron differentiation; GO:0030318 melanocyte differentiation; GO:0030334 regulation of cell migration; GO:0030593 neutrophil chemotaxis; GO:0031175 neuron projection development; GO:0042310 vasoconstriction; GO:0043406 positive regulation of MAP kinase activity; GO:0045597 positive regulation of cell differentiation; GO:0045840 positive regulation of mitotic nuclear division; GO:0046887 positive regulation of hormone secretion; GO:0048070 regulation of developmental pigmentation; GO:0048675 axon extension; GO:0051649 establishment of localization in cell; GO:0071805 potassium ion transmembrane transport; GO:0097746 blood vessel diameter maintenance; GO:1901381 positive regulation of potassium ion transmembrane transport
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  CTCFTYKDKECVYYCHLDIIW
  • Length:  21
  • Propeptide:  MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
  • Signal peptide:  MEPGLWLLFGLTVTSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endothelium-derived vasoconstrictor peptides
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  EDNRA, EDNRB
  • Target Unid:  P25101, P24530
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  1-15; 3-11
  • Structure ID:  AF-P14138-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000863_AF2.pdbhor000863_ESM.pdb

Physical Information

Mass: 300403 Formula: C121H172N26O33S4
Absent amino acids: AGMNPQRS Common amino acids: C
pI: 5.51 Basic residues: 3
Polar residues: 9 Hydrophobic residues: 6
Hydrophobicity: 10 Boman Index: -1634
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 69.52
Instability Index: 5614.76 Extinction Coefficient cystines: 10220
Absorbance 280nm: 511

Literature

  • PubMed ID:  NA
  • Title:  NA